CDS

Accession Number TCMCG016C13526
gbkey CDS
Protein Id OMO78387.1
Location complement(join(29472..29548,30109..30202,31850..31921))
Organism Corchorus capsularis
locus_tag CCACVL1_14409

Protein

Length 80aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA215142; BioSample:SAMN03290679;
db_source AWWV01010569.1
Definition Signal recognition particle, SRP9 subunit [Corchorus capsularis]
Locus_tag CCACVL1_14409

EGGNOG-MAPPER Annotation

COG_category J
Description Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding
KEGG_TC 3.A.5.9
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko02044        [VIEW IN KEGG]
KEGG_ko ko:K03109        [VIEW IN KEGG]
EC -
KEGG_Pathway ko03060        [VIEW IN KEGG]
map03060        [VIEW IN KEGG]
GOs GO:0003674        [VIEW IN EMBL-EBI]
GO:0005047        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005783        [VIEW IN EMBL-EBI]
GO:0005785        [VIEW IN EMBL-EBI]
GO:0005786        [VIEW IN EMBL-EBI]
GO:0005789        [VIEW IN EMBL-EBI]
GO:0005791        [VIEW IN EMBL-EBI]
GO:0006605        [VIEW IN EMBL-EBI]
GO:0006612        [VIEW IN EMBL-EBI]
GO:0006613        [VIEW IN EMBL-EBI]
GO:0006614        [VIEW IN EMBL-EBI]
GO:0006616        [VIEW IN EMBL-EBI]
GO:0006810        [VIEW IN EMBL-EBI]
GO:0006886        [VIEW IN EMBL-EBI]
GO:0008104        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0012505        [VIEW IN EMBL-EBI]
GO:0015031        [VIEW IN EMBL-EBI]
GO:0015833        [VIEW IN EMBL-EBI]
GO:0016020        [VIEW IN EMBL-EBI]
GO:0030867        [VIEW IN EMBL-EBI]
GO:0031090        [VIEW IN EMBL-EBI]
GO:0031984        [VIEW IN EMBL-EBI]
GO:0032991        [VIEW IN EMBL-EBI]
GO:0033036        [VIEW IN EMBL-EBI]
GO:0033365        [VIEW IN EMBL-EBI]
GO:0034613        [VIEW IN EMBL-EBI]
GO:0042175        [VIEW IN EMBL-EBI]
GO:0042886        [VIEW IN EMBL-EBI]
GO:0043021        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044425        [VIEW IN EMBL-EBI]
GO:0044432        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0044877        [VIEW IN EMBL-EBI]
GO:0045047        [VIEW IN EMBL-EBI]
GO:0045184        [VIEW IN EMBL-EBI]
GO:0046907        [VIEW IN EMBL-EBI]
GO:0048500        [VIEW IN EMBL-EBI]
GO:0051179        [VIEW IN EMBL-EBI]
GO:0051234        [VIEW IN EMBL-EBI]
GO:0051641        [VIEW IN EMBL-EBI]
GO:0051649        [VIEW IN EMBL-EBI]
GO:0055085        [VIEW IN EMBL-EBI]
GO:0065002        [VIEW IN EMBL-EBI]
GO:0070727        [VIEW IN EMBL-EBI]
GO:0070972        [VIEW IN EMBL-EBI]
GO:0071702        [VIEW IN EMBL-EBI]
GO:0071705        [VIEW IN EMBL-EBI]
GO:0071806        [VIEW IN EMBL-EBI]
GO:0072594        [VIEW IN EMBL-EBI]
GO:0072599        [VIEW IN EMBL-EBI]
GO:0072657        [VIEW IN EMBL-EBI]
GO:0090150        [VIEW IN EMBL-EBI]
GO:0098588        [VIEW IN EMBL-EBI]
GO:0098796        [VIEW IN EMBL-EBI]
GO:0098827        [VIEW IN EMBL-EBI]
GO:1990904        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGGTTTACATAACATCGTGGGACGAATTCGTCGAGCGAACCGTACAGTTGTTCCGTGCCGATCCTGAATCTTGCCTTAAGTTTAAGACAGATCAAGCACAGGAGGCTAAGAAGATGGAGAAACTTAACAATATATTCTTCACTTTGATGGCTAGGGGACCTGATGTGGACATGTCAGAAATTACAGGGAAAGAACAGACTGAAGCACAGCCAGCAAAGAAAGGAAGGGGAAGAAAACAGTAG
Protein:  
MVYITSWDEFVERTVQLFRADPESCLKFKTDQAQEAKKMEKLNNIFFTLMARGPDVDMSEITGKEQTEAQPAKKGRGRKQ